Lineage for d3fook_ (3foo K:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311322Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2311323Family a.24.3.1: Cytochrome b562 [47176] (2 protein domains)
    automatically mapped to Pfam PF07361
  6. 2311324Protein Cytochrome b562 [47177] (1 species)
  7. 2311325Species Escherichia coli [TaxId:562] [47178] (41 PDB entries)
  8. 2311409Domain d3fook_: 3foo K: [175945]
    automated match to d1qq3a_
    complexed with hem, ni, pxx

Details for d3fook_

PDB Entry: 3foo (more details), 2.4 Å

PDB Description: A Triangular Cytochrome b562 Superstructure Mediated by Ni Coordination - Monoclinic Form
PDB Compounds: (K:) Soluble cytochrome b562

SCOPe Domain Sequences for d3fook_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fook_ a.24.3.1 (K:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3fook_:

Click to download the PDB-style file with coordinates for d3fook_.
(The format of our PDB-style files is described here.)

Timeline for d3fook_: