PDB entry 3fht

View 3fht on RCSB PDB site
Description: Crystal structure of human Dbp5 in complex with AMPPNP and RNA
Class: hydrolase/RNA
Keywords: Dbp5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, Nup214, CAN, Nup159, DDX19b, nuclear pore, gle1, ATP-binding, Helicase, Hydrolase, Membrane, mRNA transport, Nuclear pore complex, Nucleotide-binding, Nucleus, Phosphoprotein, Protein transport, RNA-binding, Translocation, Transport, HYDROLASE-RNA COMPLEX
Deposited on 2008-12-10, released 2009-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DDX19B
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX19B (Dbp5)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fhta1, d3fhta2
  • Chain 'B':
    Compound: ATP-dependent RNA helicase DDX19B
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX19B (Dbp5)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fhtb1, d3fhtb2
  • Chain 'C':
    Compound: RNA (5'-r(*up*up*up*up*up*up*up*up*up*u)-3')
    Species:
    Gene:
  • Chain 'D':
    Compound: RNA (5'-r(*up*up*up*up*up*up*up*up*up*u)-3')
    Species:
    Gene:
  • Heterogens: MG, GOL, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fhtA (A:)
    snlvdntnqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplml
    aeppqnliaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgk
    fypelklayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvm
    iatqghqdqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkreeetldti
    kqyyvlcssrdekfqalcnlygaitiaqamifchtrktaswlaaelskeghqvallsgem
    mveqraavierfregkekvlvttnvcargidveqvsvvinfdlpvdkdgnpdnetylhri
    grtgrfgkrglavnmvdskhsmnilnriqehfnkkierldtddldeiekian
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fhtA (A:)
    nqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmlaeppqnl
    iaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkfypelkl
    ayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmiatqghq
    dqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkreeetldtikqyyvlc
    ssrdekfqalcnlygaitiaqamifchtrktaswlaaelskeghqvallsgemmveqraa
    vierfregkekvlvttnvcargidveqvsvvinfdlpvdkdgnpdnetylhrigrtgrfg
    krglavnmvdskhsmnilnriqehfnkkierl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fhtB (B:)
    snlvdntnqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplml
    aeppqnliaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgk
    fypelklayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvm
    iatqghqdqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkreeetldti
    kqyyvlcssrdekfqalcnlygaitiaqamifchtrktaswlaaelskeghqvallsgem
    mveqraavierfregkekvlvttnvcargidveqvsvvinfdlpvdkdgnpdnetylhri
    grtgrfgkrglavnmvdskhsmnilnriqehfnkkierldtddldeiekian
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fhtB (B:)
    nqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmlaeppqnl
    iaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkfypelkl
    ayavrgnkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmiatqghqdqsiri
    qrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkreeetldtikqyyvlcssrdek
    fqalcnlygaitiaqamifchtrktaswlaaelskeghqvallsgemmveqraavierfr
    egkekvlvttnvcargidveqvsvvinfdlpvdkdgnpdnetylhrigrtgrfgkrglav
    nmvdskhsmnilnriqehfnkkierld
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.