PDB entry 3fh9

View 3fh9 on RCSB PDB site
Description: Crystal structure determination of indian flying fox (Pteropus giganteus) at 1.62 A resolution
Class: oxygen transport
Keywords: megachiroptera, Pteropus giganteus, high oxygen affinity animal, volant mammal, allosteric mechanism, OXYGEN TRANSPORT
Deposited on 2008-12-09, released 2009-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: Pteropus giganteus [TaxId:143291]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FH9 (0-140)
    Domains in SCOPe 2.08: d3fh9a_
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Pteropus giganteus [TaxId:143291]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FH9 (0-145)
    Domains in SCOPe 2.08: d3fh9b_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3fh9A (A:)
vlsstdksnvkaawdkvggnvgeygaealermflsfpttktyfphfdlahgssqvkahgk
kvgdaltnavghiddlpgalsalsdlhayklrvdpvnfkllshcllvtlashlpsdftpa
vhasldkflasvstvltskyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3fh9B (B:)
vhlsgeekaavtglwgkvkvdevggealgrllvvypwtqrffdsfgdlssasavmgnpkv
kahgkkvldsfseglqhldnlkgtfaklselhcdklhvdpenfrllgnvlvcvlarhfgk
eftpqvqaayqkvvagvanalahkyh