SCOPe 2.08: Domain d3fh9a_: 3fh9 A:

Lineage for d3fh9a_ (3fh9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Pteropus giganteus [TaxId:143291] [188768] (1 PDB entry)

8. Domain d3fh9a_: 3fh9 A: [175781]
   automated match to d1aj9a_
   complexed with hem, oxy

Details for d3fh9a_

PDB Entry: 3fh9, 1.62 Å

PDB Description: crystal structure determination of indian flying fox (pteropus giganteus) at 1.62 a resolution

PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d3fh9a_:

Sequence; same for both SEQRES and ATOM records:

>d3fh9a_ a.1.1.2 (A:) automated matches {Pteropus giganteus [TaxId: 143291]}
vlsstdksnvkaawdkvggnvgeygaealermflsfpttktyfphfdlahgssqvkahgk
kvgdaltnavghiddlpgalsalsdlhayklrvdpvnfkllshcllvtlashlpsdftpa
vhasldkflasvstvltskyr

Timeline for d3fh9a_:

• d3fh9a_ first appeared in SCOPe 2.01
  
• d3fh9a_ appears in SCOPe 2.07