PDB entry 3fdo

View 3fdo on RCSB PDB site
Description: Structure of human MDMX in complex with high affinity peptide
Class: cell cycle
Keywords: MDMX, MDM4, MDM-X, MDM-4, p53, MDM2, CELL CYCLE
Deposited on 2008-11-26, released 2008-12-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.183
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Mdm4
    Species: Homo sapiens [TaxId:9606]
    Gene: mdm4, mdmx
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15151 (1-89)
      • expression tag (0)
    Domains in SCOPe 2.02: d3fdoa_
  • Chain 'B':
    Compound: Synthetic high affinity peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3FDO (0-11)
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fdoA (A:)
    iqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdll
    gellgrqsfsvkdpsplydmlrknlvtlat
    

  • Chain 'B':
    No sequence available.