PDB entry 3fb5
View 3fb5 on RCSB PDB site
Description: KcsA potassium channel in the partially open state with 14.5 A opening at T112
Class: membrane protein/metal transport
Keywords: kcsa, open, inactivation, potassium channel, Cell membrane, Ion transport, Ionic channel, Membrane, Transmembrane, Transport, Voltage-gated channel, membrane protein-metal transport COMPLEX
Deposited on
2008-11-18, released
2010-05-19
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-02-09, with a file datestamp of
2011-02-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.243
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: antibody fab fragment heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: antibody fab fragment light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Voltage-gated potassium channel
Species: Streptomyces lividans [TaxId:1916]
Gene: kcsA, skc1
Database cross-references and differences (RAF-indexed):
- Uniprot P0A334
- engineered (4)
- engineered (69)
Domains in SCOPe 2.02: d3fb5c_ - Heterogens: K, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>3fb5C (C:)
gsalqwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygd
lypvtlwgrcvavvvmvagitsfglvtaalatwfvgqeqqqqgq
Sequence, based on observed residues (ATOM records): (download)
>3fb5C (C:)
qwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlypv
tlwgrcvavvvmvagitsfglvtaalatwf