PDB entry 3fa6
View 3fa6 on RCSB PDB site
Description: Crystal structure of the R132K:Y134F:R111L:L121D:T54V mutant of cellular retinoic acid-binding protein II complexed with C15-aldehyde (a retinal analog) at 1.54 angstrom resolution
Class: transport protein
Keywords: CRABPII, retinal, protonated Schiff base, PSB, C15-aldehyde, retinoic acid, retinoid, Cytoplasm, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN
Deposited on
2008-11-15, released
2009-10-27
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-10-27, with a file datestamp of
2009-10-23.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.174
AEROSPACI score: 0.63
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cellular retinoic acid-binding protein 2
Species: Homo sapiens [TaxId:9606]
Gene: CRABP2
Database cross-references and differences (RAF-indexed):
- Uniprot P29373 (0-136)
- engineered (53)
- engineered (110)
- engineered (120)
- engineered (131)
- engineered (133)
Domains in SCOPe 2.03: d3fa6a_ - Chain 'B':
Compound: Cellular retinoic acid-binding protein 2
Species: Homo sapiens [TaxId:9606]
Gene: CRABP2
Database cross-references and differences (RAF-indexed):
- Uniprot P29373 (0-136)
- engineered (53)
- engineered (110)
- engineered (120)
- engineered (131)
- engineered (133)
Domains in SCOPe 2.03: d3fa6b_ - Heterogens: LSR, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3fa6A (A:)
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyikvsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
dtmtaddvvctkvfvre
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3fa6B (B:)
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyikvsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
dtmtaddvvctkvfvre