PDB entry 3f9q

View 3f9q on RCSB PDB site
Description: Re-refinement of uncomplexed plasmepsin II from Plasmodium falciparum.
Class: hydrolase
Keywords: hydrolase, Aspartyl protease, Glycoprotein, Protease, Vacuole, Zymogen
Deposited on 2008-11-14, released 2009-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasmepsin-2
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46925 (0-328)
      • engineered (204)
    Domains in SCOPe 2.07: d3f9qa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f9qA (A:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f9qA (A:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvikvp
    yvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdp
    fmrkyftvfdydnhsvgialakknl