Lineage for d3f9qa_ (3f9q A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060885Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 2060886Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)
  8. 2060896Domain d3f9qa_: 3f9q A: [175601]
    automated match to d1leea_

Details for d3f9qa_

PDB Entry: 3f9q (more details), 1.9 Å

PDB Description: Re-refinement of uncomplexed plasmepsin II from Plasmodium falciparum.
PDB Compounds: (A:) Plasmepsin-2

SCOPe Domain Sequences for d3f9qa_:

Sequence, based on SEQRES records: (download)

>d3f9qa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

Sequence, based on observed residues (ATOM records): (download)

>d3f9qa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvikvp
yvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdp
fmrkyftvfdydnhsvgialakknl

SCOPe Domain Coordinates for d3f9qa_:

Click to download the PDB-style file with coordinates for d3f9qa_.
(The format of our PDB-style files is described here.)

Timeline for d3f9qa_: