PDB entry 3f9d

View 3f9d on RCSB PDB site
Description: Crystal structure of the R132K:R111L:T54E mutant of cellular retinoic acid-binding protein II complexed with C15-aldehyde (a retinal analog) at 2.00 angstrom resolution
Class: transport protein
Keywords: CRABPII, retinal, protonated Schiff base, PSB, C15-aldehyde, retinoic acid, retinoid, Cytoplasm, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN
Deposited on 2008-11-13, released 2009-10-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cellular retinoic acid-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: CRABP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29373 (0-136)
    • engineered (53)
    • engineered (110)
    • engineered (131)
  Domains in SCOPe 2.06: d3f9da_
• Chain 'B':
  Compound: Cellular retinoic acid-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: CRABP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29373 (0-136)
    • engineered (53)
    • engineered (110)
    • engineered (131)
  Domains in SCOPe 2.06: d3f9db_
• Heterogens: LSR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3f9dA (A:)
  pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyikesttvrt
  teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
  ltmtaddvvctkvyvre
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3f9dB (B:)
  pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyikesttvrt
  teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
  ltmtaddvvctkvyvre