PDB entry 3ezb

View 3ezb on RCSB PDB site
Description: complex of the amino terminal domain of enzyme I and the histidine-containing phosphocarrier protein hpr from escherichia coli
Class: transferase
Keywords: phosphotransferase, kinase, sugar transport
Deposited on 1998-11-03, released 1999-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphotransfer system, enzyme I)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08839 (0-258)
      • conflict (258)
    Domains in SCOPe 2.06: d3ezba1, d3ezba2
  • Chain 'B':
    Compound: protein (phosphocarrier protein hpr)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ezbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezbA (A:)
    misgilaspgiafgkalllkedeividrkkisadqvdqeverflsgrakasaqletiktk
    agetfgeekeaifeghimlledeeleqeiialikdkhmtadaaaheviegqasaleeldd
    eylkeraadvrdigkrllrnilglkiidlsaiqdevilvaadltpsetaqlnlkkvlgfi
    tdaggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmr
    avqeqvasekaelaklkdr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezbB (B:)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele