PDB entry 3exi

View 3exi on RCSB PDB site
Description: Crystal structure of the pyruvate dehydrogenase (E1p) component of human pyruvate dehydrogenase complex with the subunit-binding domain (SBD) of E2p, but SBD cannot be modeled into the electron density
Class: oxidoreductase
Keywords: heterotetramer; thiamine diphosphate-dependent enzyme; Disease mutation; Glycolysis; Leigh syndrome; Mitochondrion; Oxidoreductase; Phosphoprotein; Alternative splicing; Polymorphism; Pyruvate; Thiamine pyrophosphate; Transit peptide, OXIDOREDUCTASE
Deposited on 2008-10-16, released 2008-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (11-20)
      • engineered (109)
    Domains in SCOPe 2.06: d3exia1, d3exia2
  • Chain 'B':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3exib1, d3exib2
  • Heterogens: K, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3exiA (A:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitafrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtsveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvsyrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exiA (A:)
    sglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkad
    qlykqkiirgfchlcdgqeaccvgleaginptdhlitafrahgftftrglsvreilaelt
    grkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaa
    nqgqifeaynmaalwklpcificennrtdyykrgdfipglrvdgmdilcvreatrfaaay
    crsgkgpilmelqtysdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpe
    ppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exiB (B:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni