PDB entry 3ene

View 3ene on RCSB PDB site
Description: Complex of PI3K gamma with an inhibitor
Class: transferase
Keywords: lipid kinase, phosphoinositide, inhibitor, 3-kinase, signaling, pyrazolopyrimidine, PIK-208, S2, Kinase, Transferase
Deposited on 2008-09-25, released 2008-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3enea1, d3enea2, d3enea3, d3enea4
  • Heterogens: NPZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eneA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
    sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeew
    plvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvfv
    eaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapalss
    kasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadklt
    satnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatdp
    lnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsald
    vgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfllk
    rglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqviemlq
    kvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekckv
    maskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldlc
    llpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfqa
    averfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginkerv
    pfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqlt
    skedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eneA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakqdfvlrvcg
    rdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeewcdrkfrvkirgid
    ipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgall
    nlqiycrllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisil
    ldnhpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssv
    kwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddv
    lhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavi
    leaylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqn
    sqlpesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgd
    dlrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstv
    gntgafkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimite
    tgnlfhidfghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnllii
    lfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflh
    lvl