PDB entry 3e9l

View 3e9l on RCSB PDB site
Description: Crystal Structure of Human Prp8, Residues 1755-2016
Class: RNA binding protein, splicing
Keywords: nucleotidyl transfer, Disease mutation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Retinitis pigmentosa, RNA-binding, Sensory transduction, Spliceosome, Vision, RNA BINDING PROTEIN, SPLICING
Deposited on 2008-08-22, released 2008-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-processing-splicing factor 8
    Species: Homo sapiens [TaxId:9606]
    Gene: PRPF8, PRPC8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e9la1
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e9lA (A:)
    epylssqnygelfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlfl
    kiihtsvwagqkrlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldf
    pnivikgselqlpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlili
    lralhvnndrakvilkpdkttitephhiwptltdeewikvevqlkdliladygkknnvnv
    asltqseirdiilgmei