PDB entry 3e5o

View 3e5o on RCSB PDB site
Description: Carbonmonoxy Sperm Whale Myoglobin at 140 K: Laser off
Class: oxygen transport
Keywords: haem protein, myoglobin, ligand migration, photodissociation, Heme, Iron, Metal-binding, Muscle protein, Oxygen transport, Transport
Deposited on 2008-08-14, released 2009-02-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.158
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3e5oa_
  • Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e5oA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg