PDB entry 3e5i

View 3e5i on RCSB PDB site
Description: Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser off
Class: oxygen transport
Keywords: haem protein, myoglobin, ligand migration, photodissociation, Heme, Iron, Metal-binding, Muscle protein, Oxygen transport, Transport
Deposited on 2008-08-14, released 2009-02-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: 0.156
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3e5ia_
  • Heterogens: HEM, CMO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e5iA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg