PDB entry 3e22

View 3e22 on RCSB PDB site
Description: Tubulin-colchicine-soblidotin: Stathmin-like domain complex
Class: cell cycle
Keywords: alpha-tubulin, beta-tubulin, colchicine, gtpase, microtubule, soblidotin, stathmin, tubulin, CELL CYCLE
Deposited on 2008-08-05, released 2008-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.231
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha-1C chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Tubulin beta-2B chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B856
      • see remark 999 (200)
      • see remark 999 (315)
  • Chain 'C':
    Compound: Tubulin alpha-1C chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Tubulin beta-2B chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B856
      • see remark 999 (200)
      • see remark 999 (315)
  • Chain 'E':
    Compound: Stathmin-4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: STMN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63043 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3e22e1, d3e22e2
  • Heterogens: GTP, MG, GDP, LOC, TZT

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >3e22E (E:)
admevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelkeeasr

    Sequence, based on observed residues (ATOM records): (download) 
    >3e22E (E:)
admevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekre
hereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknk
elke