Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
Domain d3e22e1: 3e22 E:5-141 [157987] Other proteins in same PDB: d3e22e2 automatically matched to d1sa0e_ complexed with gdp, gtp, loc, mg, tzt |
PDB Entry: 3e22 (more details), 3.8 Å
SCOPe Domain Sequences for d3e22e1:
Sequence, based on SEQRES records: (download)
>d3e22e1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} dmevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyq eaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlq ekdkhaeevrknkelke
>d3e22e1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} dmevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekreh ereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknke lke
Timeline for d3e22e1: