PDB entry 3e0v

View 3e0v on RCSB PDB site
Description: Crystal structure of pyruvate kinase from Leishmania mexicana in complex with sulphate ions
Class: transferase
Keywords: PYRUVATE, KINASE, NAD+ NADH, ADP, PHOSPHOENOLPYRUVATE, PEP, GLYCOLYSIS, TRYPANOSOMATID, LEISHMANIA, MEXICANA, Allosteric enzyme, Magnesium, Metal-binding, Transferase
Deposited on 2008-08-01, released 2008-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.23
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (40-538)
      • expression tag (39)
      • conflict (422)
      • conflict (429)
      • conflict (444-445)
      • engineered (491)
    Domains in SCOPe 2.06: d3e0va1, d3e0va2, d3e0va3, d3e0va4
  • Chain 'B':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (40-538)
      • expression tag (38-39)
      • conflict (422)
      • conflict (429)
      • conflict (444-445)
      • engineered (491)
    Domains in SCOPe 2.06: d3e0vb1, d3e0vb2, d3e0vb3, d3e0vb4
  • Chain 'C':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (40-538)
      • expression tag (39)
      • conflict (422)
      • conflict (429)
      • conflict (444-445)
      • engineered (491)
    Domains in SCOPe 2.06: d3e0vc1, d3e0vc2, d3e0vc3, d3e0vc4
  • Chain 'D':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (40-538)
      • expression tag (38-39)
      • conflict (422)
      • conflict (429)
      • conflict (444-445)
      • engineered (491)
    Domains in SCOPe 2.06: d3e0vd1, d3e0vd2, d3e0vd3, d3e0vd4
  • Chain 'E':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (40-538)
      • expression tag (38-39)
      • conflict (422)
      • conflict (429)
      • conflict (444-445)
      • engineered (491)
    Domains in SCOPe 2.06: d3e0ve1, d3e0ve2, d3e0ve3, d3e0ve4
  • Chain 'F':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (40-538)
      • expression tag (37-39)
      • conflict (422)
      • conflict (429)
      • conflict (444-445)
      • engineered (491)
    Domains in SCOPe 2.06: d3e0vf1, d3e0vf2, d3e0vf3, d3e0vf4
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e0vA (A:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmsqlahnltlsifdpvanyr
    aariictigpstqsvealkgliqsgmsvarmnfshgsheyhqttinnvrqaaaelgvnia
    ialdtkgpeirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgn
    yiyiddgililqvqshedeqtlectvtnshtisdrrgvnlpgcdvdlpavsakdrvdlqf
    gveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickienhqgvqnidsiieesdgim
    vargdlgveipaekvvvaqkiliskcnvagkpvicatqmlesmtynprptraevsdvana
    vfngadcvmlsgetakgkypnevvqymaricleaqsalneyvffnsikklqhipmsadea
    vcssavnsvyetkakamvvlsntgrsarlvakyrpncpivcvttrlqtcrqlnitqgves
    vffdadklghdwgkehrvaagvefakskgyvqtgdycvvihadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e0vA (A:)
    hmsqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshe
    yhqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadk
    gtkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvn
    lpgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiick
    ienhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqm
    lesmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsaln
    eyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpi
    vcvttrlqtcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdycvv
    ihadanqtrillve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e0vB (B:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmsqlahnltlsifdpvanyr
    aariictigpstqsvealkgliqsgmsvarmnfshgsheyhqttinnvrqaaaelgvnia
    ialdtkgpeirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgn
    yiyiddgililqvqshedeqtlectvtnshtisdrrgvnlpgcdvdlpavsakdrvdlqf
    gveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickienhqgvqnidsiieesdgim
    vargdlgveipaekvvvaqkiliskcnvagkpvicatqmlesmtynprptraevsdvana
    vfngadcvmlsgetakgkypnevvqymaricleaqsalneyvffnsikklqhipmsadea
    vcssavnsvyetkakamvvlsntgrsarlvakyrpncpivcvttrlqtcrqlnitqgves
    vffdadklghdwgkehrvaagvefakskgyvqtgdycvvihadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e0vB (B:)
    shmsqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsh
    eyhqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafad
    kgtkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgv
    nlpgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiic
    kienhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatq
    mlesmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsal
    neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
    ivcvttrlqtcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdycv
    vihadgyanqtrillve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e0vC (C:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmsqlahnltlsifdpvanyr
    aariictigpstqsvealkgliqsgmsvarmnfshgsheyhqttinnvrqaaaelgvnia
    ialdtkgpeirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgn
    yiyiddgililqvqshedeqtlectvtnshtisdrrgvnlpgcdvdlpavsakdrvdlqf
    gveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickienhqgvqnidsiieesdgim
    vargdlgveipaekvvvaqkiliskcnvagkpvicatqmlesmtynprptraevsdvana
    vfngadcvmlsgetakgkypnevvqymaricleaqsalneyvffnsikklqhipmsadea
    vcssavnsvyetkakamvvlsntgrsarlvakyrpncpivcvttrlqtcrqlnitqgves
    vffdadklghdwgkehrvaagvefakskgyvqtgdycvvihadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e0vC (C:)
    hmsqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshe
    yhqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadk
    gtkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvn
    lpgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiick
    ienhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqm
    lesmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsaln
    eyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpi
    vcvttrlqtcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdycvv
    ihadanqtrillve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e0vD (D:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmsqlahnltlsifdpvanyr
    aariictigpstqsvealkgliqsgmsvarmnfshgsheyhqttinnvrqaaaelgvnia
    ialdtkgpeirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgn
    yiyiddgililqvqshedeqtlectvtnshtisdrrgvnlpgcdvdlpavsakdrvdlqf
    gveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickienhqgvqnidsiieesdgim
    vargdlgveipaekvvvaqkiliskcnvagkpvicatqmlesmtynprptraevsdvana
    vfngadcvmlsgetakgkypnevvqymaricleaqsalneyvffnsikklqhipmsadea
    vcssavnsvyetkakamvvlsntgrsarlvakyrpncpivcvttrlqtcrqlnitqgves
    vffdadklghdwgkehrvaagvefakskgyvqtgdycvvihadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e0vD (D:)
    shmsqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsh
    eyhqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafad
    kgtkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgv
    nlpgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiic
    kienhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatq
    mlesmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsal
    neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
    ivcvttrlqtcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdycv
    vihadanqtrillve
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3e0vE (E:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmsqlahnltlsifdpvanyr
    aariictigpstqsvealkgliqsgmsvarmnfshgsheyhqttinnvrqaaaelgvnia
    ialdtkgpeirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgn
    yiyiddgililqvqshedeqtlectvtnshtisdrrgvnlpgcdvdlpavsakdrvdlqf
    gveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickienhqgvqnidsiieesdgim
    vargdlgveipaekvvvaqkiliskcnvagkpvicatqmlesmtynprptraevsdvana
    vfngadcvmlsgetakgkypnevvqymaricleaqsalneyvffnsikklqhipmsadea
    vcssavnsvyetkakamvvlsntgrsarlvakyrpncpivcvttrlqtcrqlnitqgves
    vffdadklghdwgkehrvaagvefakskgyvqtgdycvvihadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e0vE (E:)
    shmsqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsh
    eyhqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafad
    kgtkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgv
    nlpgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiic
    kienhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatq
    mlesmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsal
    neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
    ivcvttrlqtcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdycv
    vihadanqtrillve
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3e0vF (F:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmsqlahnltlsifdpvanyr
    aariictigpstqsvealkgliqsgmsvarmnfshgsheyhqttinnvrqaaaelgvnia
    ialdtkgpeirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgn
    yiyiddgililqvqshedeqtlectvtnshtisdrrgvnlpgcdvdlpavsakdrvdlqf
    gveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickienhqgvqnidsiieesdgim
    vargdlgveipaekvvvaqkiliskcnvagkpvicatqmlesmtynprptraevsdvana
    vfngadcvmlsgetakgkypnevvqymaricleaqsalneyvffnsikklqhipmsadea
    vcssavnsvyetkakamvvlsntgrsarlvakyrpncpivcvttrlqtcrqlnitqgves
    vffdadklghdwgkehrvaagvefakskgyvqtgdycvvihadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e0vF (F:)
    gshmsqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgs
    heyhqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafa
    dkgtkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrg
    vnlpgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimii
    ckienhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicat
    qmlesmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsa
    lneyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpnc
    pivcvttrlqtcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdyc
    vvihadanqtrillve