PDB entry 3dar

View 3dar on RCSB PDB site
Description: Crystal structure of D2 domain from human FGFR2
Class: transferase
Keywords: IMMUNOGLOBULIN FOLD, ATP-binding, Craniosynostosis, Disease mutation, Ectodermal dysplasia, Glycoprotein, Heparin-binding, Immunoglobulin domain, Kinase, Lacrimo-auriculo-dento-digital syndrome, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Secreted, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-05-30, released 2008-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dara_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3darb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3darA (A:)
    mensnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehri
    ggykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3darA (A:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3darB (B:)
    mensnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehri
    ggykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3darB (B:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvv