PDB entry 3d84

View 3d84 on RCSB PDB site
Description: Structural Analysis of a Holo Enzyme Complex of Mouse Dihydrofolate Reductase with NADPH and a Ternary Complex with the Potent and Selective Inhibitor 2.4-Diamino-6-(-2'-hydroxydibenz[b,f]azepin-5-yl)methylpteridine
Class: oxidoreductase
Keywords: mouse DHFR holo enzyme and ternary ligand complex, NADP, One-carbon metabolism, Oxidoreductase
Deposited on 2008-05-22, released 2008-09-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: dihydrofolate reductase
  Species: Mus musculus [TaxId:10090]
  Gene: Dhfr
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00375 (0-185)
  Domains in SCOPe 2.04: d3d84x_
• Heterogens: NDP, GOL, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d84X (X:)
  vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
  peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
  yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
  vyekkd