PDB entry 3cx6

View 3cx6 on RCSB PDB site
Description: Crystal Structure of PDZRhoGEF rgRGS Domain in a Complex with Galpha-13 Bound to GDP
Class: signaling protein
Keywords: SIGNAL TRANSDUCTION, PROTEIN COMPLEX, GTP-binding, Lipoprotein, Membrane, Nucleotide-binding, Palmitate, Phosphoprotein, Transducer, Coiled coil, Cytoplasm, GTPase activation, Guanine-nucleotide releasing factor, SIGNALING PROTEIN
Deposited on 2008-04-23, released 2008-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein alpha-13 subunit
    Species: Mus musculus [TaxId:10090]
    Gene: Gna13, Gna-13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27601
      • engineered (186)
  • Chain 'B':
    Compound: Rho guanine nucleotide exchange factor 11
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Arhgef11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cx6b_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3cx6B (B:)
gliigpeedydpgyfnnesdiifqdleklkshpaylvvflryilsqadpgpllfylcsev
yqqtnpkdsrslgkdiwnifleknaplrvkipemlqaeidlrlrnnedprnvlceaqeav
mleiqeqindyrskrtlglgslygendllgldgdplrerqmaekqlaalgdilskyeedr
sapmdfavntfmshagirlresr

    Sequence, based on observed residues (ATOM records): (download) 
    >3cx6B (B:)
liigpeeesdiifqdleklkshpaylvvflryilsqadpgpllfylcsevyqqtnpksrs
lgkdiwnifleknaplrvkipemlqaeidlrrnnedprnvlceaqeavmleiqeqindyr
skrtlglgslygendllgldgdplrerqmaekqlaalgdilskyeedrsapmdfavntfm
shagi