PDB entry 3cru

View 3cru on RCSB PDB site
Description: Structural characterization of an engineered allosteric protein
Class: transferase
Keywords: protein design, allosteric switch, pH-response, Transferase
Deposited on 2008-04-07, released 2009-02-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase class-mu 26 kDa isozyme
    Species: Schistosoma japonicum [TaxId:6182]
    Gene: GST
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08515 (0-213)
      • engineered (49)
    Domains in SCOPe 2.04: d3crua1, d3crua2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cruA (A:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelgcefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggd