PDB entry 3cmy

View 3cmy on RCSB PDB site
Description: Structure of a homeodomain in complex with DNA
Class: transcription regulator/DNA
Keywords: DNA-binding protein, DNA, transcription regulation, transcription regulator-DNA complex
Deposited on 2008-03-24, released 2009-02-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.174
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Paired box protein Pax-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PAX3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23760 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.02: d3cmya_
  • Chain 'B':
    Compound: 5'-d(*dap*dcp*dap*dtp*dap*dap*dp*dcp*dgp*dap*dtp*dtp*dap*dc)-3'
  • Chain 'C':
    Compound: 5'-d(*dtp*dgp*dtp*dap*dap*dtp*dcp*dgp*dap*dtp*dtp*dap*dtp*dg)-3'
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3cmyA (A:)
gqrrsrttftaeqleeleraferthypdiytreelaqrakltearvqvwfsnrrarwrkq
a

    Sequence, based on observed residues (ATOM records): (download) 
    >3cmyA (A:)
gqrrsrttftaeqleeleraferthypdiytreelaqrakltearvqvwfsnrrarwrkq

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.