PDB entry 3cky

View 3cky on RCSB PDB site
Description: Structural and Kinetic Properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation
Class: oxidoreductase
Keywords: rossmann fold, two domain enzyme, OXIDOREDUCTASE
Deposited on 2008-03-18, released 2008-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-hydroxymethyl glutarate dehydrogenase
    Species: Eubacterium barkeri
    Gene: Hgd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ckya1, d3ckya2
  • Chain 'B':
    Compound: 2-hydroxymethyl glutarate dehydrogenase
    Species: Eubacterium barkeri
    Gene: Hgd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ckyb1, d3ckyb2
  • Chain 'C':
    Compound: 2-hydroxymethyl glutarate dehydrogenase
    Species: Eubacterium barkeri
    Gene: Hgd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ckyc1, d3ckyc2
  • Chain 'D':
    Compound: 2-hydroxymethyl glutarate dehydrogenase
    Species: Eubacterium barkeri
    Gene: Hgd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ckyd1, d3ckyd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ckyA (A:)
    meksikigfiglgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaa
    sdiiftslpnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyv
    dapvsggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgdtgagdavkivnnll
    lgcnmaslaealvlgvkcglkpetmqeiigkssgrsyameakmekfimsgdfaggfamdl
    qhkdlglaleagkegnvplpmtamatqifeggramglgredmsavikvweqmtgvsvsgg
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ckyA (A:)
    sikigfiglgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaasdi
    iftslpnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyvdap
    vsggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgdtgagdavkivnnlllgc
    nmaslaealvlgvkcglkpetmqeiigkssgrsyameakmekfimsgdfaggfamdlqhk
    dlglaleagkegnvplpmtamatqifeggramglgredmsavikvweqmtgvsvsgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ckyB (B:)
    meksikigfiglgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaa
    sdiiftslpnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyv
    dapvsggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgdtgagdavkivnnll
    lgcnmaslaealvlgvkcglkpetmqeiigkssgrsyameakmekfimsgdfaggfamdl
    qhkdlglaleagkegnvplpmtamatqifeggramglgredmsavikvweqmtgvsvsgg
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ckyB (B:)
    sikigfiglgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaasdi
    iftslpnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyvdap
    vsggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgdtgagdavkivnnlllgc
    nmaslaealvlgvkcglkpetmqeiigkssgrsyameakmekfimsgdfaggfamdlqhk
    dlglaleagkegnvplpmtamatqifeggramglgredmsavikvweqmtgvsvsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ckyC (C:)
    meksikigfiglgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaa
    sdiiftslpnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyv
    dapvsggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgdtgagdavkivnnll
    lgcnmaslaealvlgvkcglkpetmqeiigkssgrsyameakmekfimsgdfaggfamdl
    qhkdlglaleagkegnvplpmtamatqifeggramglgredmsavikvweqmtgvsvsgg
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ckyC (C:)
    ikigfiglgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaasdii
    ftslpnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyvdapv
    sggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgdtgagdavkivnnlllgcn
    maslaealvlgvkcglkpetmqeiigkssgrsyameakmekfimsgdfaggfamdlqhkd
    lglaleagkegnvplpmtamatqifeggramglgredmsavikvweqmtgvsvsgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ckyD (D:)
    meksikigfiglgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaa
    sdiiftslpnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyv
    dapvsggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgdtgagdavkivnnll
    lgcnmaslaealvlgvkcglkpetmqeiigkssgrsyameakmekfimsgdfaggfamdl
    qhkdlglaleagkegnvplpmtamatqifeggramglgredmsavikvweqmtgvsvsgg
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ckyD (D:)
    figlgaqkvaaasdiiftslpnagivetvmntvivdmssvspsstlkmakvaaekgidyv
    dapvsggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgdtgagdavkivnnll
    lgcnmaslaealvlgvkcglkpetmqeiigkssgrsyameakmekfimsgdfaggfamdl
    qhkdlglaleagkegnvplpmtamatqifeggramglgredmsavikvweqmtgvsvsgg