| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Eubacterium barkeri [TaxId:1528] [225506] (1 PDB entry) |
| Domain d3ckyc2: 3cky C:167-300 [208895] Other proteins in same PDB: d3ckya1, d3ckyb1, d3ckyc1, d3ckyd1 automated match to d2cvza1 |
PDB Entry: 3cky (more details), 2.3 Å
SCOPe Domain Sequences for d3ckyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ckyc2 a.100.1.0 (C:167-300) automated matches {Eubacterium barkeri [TaxId: 1528]}
tgagdavkivnnlllgcnmaslaealvlgvkcglkpetmqeiigkssgrsyameakmekf
imsgdfaggfamdlqhkdlglaleagkegnvplpmtamatqifeggramglgredmsavi
kvweqmtgvsvsgg
Timeline for d3ckyc2: