PDB entry 3cjb

View 3cjb on RCSB PDB site
Description: Actin dimer cross-linked by V. cholerae MARTX toxin and complexed with Gelsolin-segment 1
Class: structural protein
Keywords: cross-linked dimer, ATP-binding, Cytoskeleton, Methylation, Muscle protein, Nucleotide-binding, Phosphoprotein, Structural protein, Actin capping, Actin-binding, Alternative initiation, Amyloid, Disease mutation, Secreted
Deposited on 2008-03-12, released 2008-03-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: 0.246
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin, alpha skeletal muscle
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: gelsolin
    Species: Homo sapiens [TaxId:9606]
    Gene: GSN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3cjbg1
  • Heterogens: CA, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cjbG (G:)
    mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
    lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
    vasgf