PDB entry 3cip

View 3cip on RCSB PDB site
Description: Complex of Dictyostelium Discoideum Actin with Gelsolin
Class: structural protein
Keywords: Actin, Gelsolin, Dictyostelium discoideum, Actin-Associated Protein, Methyl Histidine, ATP-binding, Cytoskeleton, Nucleotide-binding, Phosphoprotein, Structural protein, Actin capping, Actin-binding, Alternative initiation, Amyloid, Disease mutation, Secreted
Deposited on 2008-03-11, released 2008-08-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.152
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major actin
    Species: Dictyostelium discoideum
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: gelsolin
    Species: HOMO SAPIENS
    Gene: GSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06396 (3-127)
      • expression tag (0-2)
    Domains in SCOPe 2.02: d3cipg_
  • Heterogens: MG, SO4, CA, ATP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cipG (G:)
aghmvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnl
qydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkyk
kggvasgf