PDB entry 3cck

View 3cck on RCSB PDB site
Description: Human CD69
Class: immune system
Keywords: leukocyte activation, C-type lectin, refolding, stability, ligand binding, tumor therapies, Glycoprotein, Membrane, Phosphoprotein, Signal-anchor, Transmembrane, IMMUNE SYSTEM
Deposited on 2008-02-26, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: early activation antigen cd69
    Species: Homo sapiens [TaxId:9606]
    Gene: CD69
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ccka_
  • Chain 'B':
    Compound: early activation antigen cd69
    Species: Homo sapiens [TaxId:9606]
    Gene: CD69
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cckb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3cckA (A:)
vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk

    Sequence, based on observed residues (ATOM records): (download) 
    >3cckA (A:)
sscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreehw
vglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cckB (B:)
vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk