PDB entry 3cby

View 3cby on RCSB PDB site
Description: The Dvl2 PDZ Domain in Complex with the N1 Inhibitory Peptide
Class: protein binding
Keywords: PDZ DOMAIN, PHAGE DERIVED HIGH AFFINITY LIGAND, Cytoplasm, Developmental protein, Phosphoprotein, Wnt signaling pathway, PROTEIN BINDING
Deposited on 2008-02-23, released 2009-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dishevelled-2
    Species: Homo sapiens [TaxId:9606]
    Gene: dvl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14641 (4-94)
      • expression tag (1-3)
      • engineered (94)
      • linker (95-97)
      • see remark 999 (98-107)
    Domains in SCOPe 2.08: d3cbya1, d3cbya2
  • Chain 'B':
    Compound: Dishevelled-2
    Species: Homo sapiens [TaxId:9606]
    Gene: dvl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14641 (4-94)
      • engineered (94)
      • linker (97)
      • see remark 999 (98-107)
    Domains in SCOPe 2.08: d3cbyb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3cbyA (A:)
gshmniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllq
vndmnfenmsnddavrvlrdivhkpgpivltvaksgggwkdygwidgk

    Sequence, based on observed residues (ATOM records): (download) 
    >3cbyA (A:)
shmniitvtlnmekynflgisivgqggiyigsimkggavaadgriepgdmllqvndmnfe
nmsnddavrvlrdivhkpgpivltvaksgggwkdygwidgk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3cbyB (B:)
gshmniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllq
vndmnfenmsnddavrvlrdivhkpgpivltvaksgggwkdygwidgk

    Sequence, based on observed residues (ATOM records): (download) 
    >3cbyB (B:)
niitvtlnmekynflgisivgqsdggiyigsimkggavaadgriepgdmllqvndmnfen
msnddavrvlrdivhkpgpivltvaksgwkdygwidgk