Lineage for d3cbyb_ (3cby B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048477Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)
  7. 2048486Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries)
  8. 2048489Domain d3cbyb_: 3cby B: [173125]
    Other proteins in same PDB: d3cbya2
    automated match to d1l6oa_
    complexed with edo

Details for d3cbyb_

PDB Entry: 3cby (more details), 1.5 Å

PDB Description: the dvl2 pdz domain in complex with the n1 inhibitory peptide
PDB Compounds: (B:) Dishevelled-2

SCOPe Domain Sequences for d3cbyb_:

Sequence, based on SEQRES records: (download)

>d3cbyb_ b.36.1.1 (B:) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndm
nfenmsnddavrvlrdivhkpgpivltvaksgggwkdygwidgk

Sequence, based on observed residues (ATOM records): (download)

>d3cbyb_ b.36.1.1 (B:) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsdggiyigsimkggavaadgriepgdmllqvndmnfen
msnddavrvlrdivhkpgpivltvaksgwkdygwidgk

SCOPe Domain Coordinates for d3cbyb_:

Click to download the PDB-style file with coordinates for d3cbyb_.
(The format of our PDB-style files is described here.)

Timeline for d3cbyb_: