PDB entry 3cbx

View 3cbx on RCSB PDB site
Description: The Dvl2 PDZ Domain in Complex with the C1 Inhibitory Peptide
Class: protein binding
Keywords: PDZ DOMAIN, PHAGE DERIVED HIGH AFFINITY LIGAND, Developmental protein, Phosphoprotein, Wnt signaling pathway, SIGNALING PROTEIN, PROTEIN BINDING
Deposited on 2008-02-23, released 2009-03-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dishevelled-2
  Species: Homo sapiens [TaxId:9606]
  Gene: dvl2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14641 (4-94)
    • expression tag (0-3)
    • engineered (94)
    • linker (95-97)
    • see remark 999 (98-104)
  Domains in SCOPe 2.06: d3cbxa1, d3cbxa2
• Chain 'B':
  Compound: Dishevelled-2
  Species: Homo sapiens [TaxId:9606]
  Gene: dvl2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14641 (4-94)
    • expression tag (1-3)
    • engineered (94)
    • linker (95-97)
    • see remark 999 (98-104)
  Domains in SCOPe 2.06: d3cbxb1, d3cbxb2
• Heterogens: MPD, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cbxA (A:)
  gshmniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllq
  vndmnfenmsnddavrvlrdivhkpgpivltvaksgggwkwygwf
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3cbxB (B:)
  gshmniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllq
  vndmnfenmsnddavrvlrdivhkpgpivltvaksgggwkwygwf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3cbxB (B:)
  shmniitvtlnmekynflgisivgqsggiyigsimkggavaadgriepgdmllqvndmnf
  enmsnddavrvlrdivhkpgpivltvaksgggwkwygwf