PDB entry 3cbx

View 3cbx on RCSB PDB site
Description: The Dvl2 PDZ Domain in Complex with the C1 Inhibitory Peptide
Class: protein binding
Keywords: PDZ DOMAIN, PHAGE DERIVED HIGH AFFINITY LIGAND, Developmental protein, Phosphoprotein, Wnt signaling pathway, SIGNALING PROTEIN, PROTEIN BINDING
Deposited on 2008-02-23, released 2009-03-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dishevelled-2
    Species: Homo sapiens [TaxId:9606]
    Gene: dvl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14641 (4-94)
      • expression tag (0-3)
      • engineered (94)
      • linker (95-97)
      • see remark 999 (98-104)
    Domains in SCOPe 2.06: d3cbxa1, d3cbxa2
  • Chain 'B':
    Compound: Dishevelled-2
    Species: Homo sapiens [TaxId:9606]
    Gene: dvl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14641 (4-94)
      • expression tag (1-3)
      • engineered (94)
      • linker (95-97)
      • see remark 999 (98-104)
    Domains in SCOPe 2.06: d3cbxb1, d3cbxb2
  • Heterogens: MPD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cbxA (A:)
    gshmniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllq
    vndmnfenmsnddavrvlrdivhkpgpivltvaksgggwkwygwf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cbxB (B:)
    gshmniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllq
    vndmnfenmsnddavrvlrdivhkpgpivltvaksgggwkwygwf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cbxB (B:)
    shmniitvtlnmekynflgisivgqsggiyigsimkggavaadgriepgdmllqvndmnf
    enmsnddavrvlrdivhkpgpivltvaksgggwkwygwf