PDB entry 3cbs

View 3cbs on RCSB PDB site
Description: cellular retinoic acid binding protein ii in complex with a synthetic retinoic acid (ro-12 7310)
Deposited on 1999-02-22, released 1999-12-22
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d3cbsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cbsA (A:)
  pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
  teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
  ltmtaddvvctrvyvre