PDB entry 3c7l

View 3c7l on RCSB PDB site
Description: Molecular architecture of Galphao and the structural basis for RGS16-mediated deactivation
Class: signaling protein
Keywords: RGS, RGS16, GAP, GTPase Activating Protein, Heterotrimeric G-protein, Lipoprotein, Palmitate, Phosphoprotein, Signal transduction inhibitor, SIGNALING PROTEIN
Deposited on 2008-02-07, released 2008-05-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.222
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 16
    Species: Mus musculus [TaxId:10090]
    Gene: RGS16, RGSR
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Regulator of G-protein signaling 16
    Species: Mus musculus [TaxId:10090]
    Gene: RGS16, RGSR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3c7lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3c7lB (B:)
gshhhhhhgsfsedvlgwresfdlllnskngvaafhaflktefseenlefwlaceefkki
rsatklasrahhifdeyirseapkevnidhetreltktnlqaattscfdvaqgktrtlme
kdsyprflkspayrdla

    Sequence, based on observed residues (ATOM records): (download) 
    >3c7lB (B:)
sfsedvlgwresfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasr
ahhifdeyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflk
spayrdla