PDB entry 3c6o
View 3c6o on RCSB PDB site
Description: Small molecule agonists and antagonists of F-box protein-substrate interactions in auxin perception and signaling
Class: signaling protein
Keywords: auxin, ubiquitin ligase, F-box, small molecule, chemical biology, plant physiology, Auxin signaling pathway, Chromosome partition, Cytoskeleton, Developmental protein, Ethylene signaling pathway, Nucleus, Ubl conjugation pathway, Cell cycle, Leucine-rich repeat, Plant defense, SIGNALING PROTEIN
Deposited on
2008-02-04, released
2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-11-23, with a file datestamp of
2011-11-18.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.187
AEROSPACI score: 0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: SKP1-like protein 1A
Species: Arabidopsis thaliana [TaxId:3702]
Gene: SKP1A, ASK1, SKP1, UIP1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3c6oa1 - Chain 'B':
Compound: transport inhibitor response 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: TIR1, FBL1, WEI1
Database cross-references and differences (RAF-indexed):
- Heterogens: IHP, 2S2, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3c6oA (A:)
msakkivlkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakvieyck
rhveaaaskaeavegaatsdddlkawdadfmkidqatlfelilaanylniknlldltcqt
vadmikgktpeeirttfnikndftpeeeeevrrenqwafe
Sequence, based on observed residues (ATOM records): (download)
>3c6oA (A:)
alesqtiailakvieylilaanylniknlldltcqtvadmikgktpeeirttfnikndft
peeeeevrrenqwafe
- Chain 'B':
No sequence available.