PDB entry 3c6n

View 3c6n on RCSB PDB site
Description: Small molecule agonists and antagonists of F-box protein-substrate interactions in auxin perception and signaling
Class: signaling protein
Keywords: Auxin, ubiquitin ligase, small molecules, plant physiology, chemical biology, Auxin signaling pathway, Chromosome partition, Cytoplasm, Cytoskeleton, Developmental protein, Ethylene signaling pathway, Nucleus, Ubl conjugation pathway, Cell cycle, Leucine-rich repeat, Plant defense, SIGNALING PROTEIN
Deposited on 2008-02-04, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SKP1-like protein 1A
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SKP1A, ASK1, SKP1, UIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3c6na_
  • Chain 'B':
    Compound: transport inhibitor response 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: TIR1, FBL1, WEI1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IHP, 2S8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c6nA (A:)
    msakkivlkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakvieyck
    rhveaaaskaeavegaatsdddlkawdadfmkidqatlfelilaanylniknlldltcqt
    vadmikgktpeeirttfnikndftpeeeeevrrenqwafe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c6nA (A:)
    aanylniknlldltcqtvadmikgktpeeirttfnikndftpeeeeevrrenqwafe
    

  • Chain 'B':
    No sequence available.