PDB entry 3c15

View 3c15 on RCSB PDB site
Description: Complex of GS-Alpha with the Catalytic Domains of Mammalian Adenylyl Cyclase: Complex with Pyrophosphate and Mg
Class: lyase/lyase inhibitor
Keywords: ADENYLYL CYCLASE, GSALPHA, PYROPHOSPHATE, MAGNESIUM, Alternative splicing, cAMP biosynthesis, Glycoprotein, Lyase, Membrane, Metal-binding, Phosphoprotein, Transmembrane, GTP-binding, Lipoprotein, Nucleotide-binding, Palmitate, Transducer, LYASE/LYASE INHIBITOR COMPLEX
Deposited on 2008-01-22, released 2009-02-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.24
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylate cyclase type 5
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: ADCY5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30803
      • engineered (120)
  • Chain 'B':
    Compound: Adenylate cyclase type 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Adcy2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3c15b_
  • Chain 'C':
    Compound: Guanine nucleotide-binding protein G(s) subunit alpha isoforms short
    Species: Bos taurus [TaxId:9913]
    Gene: GNAS, GNAS1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, MG, GSP, FOK, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c15B (B:)
    rslkneelyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskp
    kfsgvekiktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkh
    sfndfklrvginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslil
    qtlgytctcrgiinvkgkgdlktyfvntemsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c15B (B:)
    hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
    tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
    vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
    dlktyfvnt
    

  • Chain 'C':
    No sequence available.