PDB entry 3bzq
View 3bzq on RCSB PDB site
Description: High resolution crystal structure of Nitrogen Regulatory Protein (Rv2919c) of Mycobacterium tuberculosis
Class: signaling protein/transcription
Keywords: P-II, GLNB, GLNK, Mycobacterium tuberculosis, signal transductory protein, Nucleotide-binding, Transcription, Transcription regulation, SIGNAL TRANSDUCTION, NITROGEN REGULATORY, SIGNALING PROTEIN-TRANSCRIPTION COMPLEX, Structural Genomics, TB Structural Genomics Consortium, TBSGC
Deposited on
2008-01-18, released
2008-04-01
The last revision prior to the SCOPe 2.04 freeze date was dated
2010-08-11, with a file datestamp of
2010-08-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.208
AEROSPACI score: 0.66
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: nitrogen regulatory protein p-II
Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
Gene: GLNB
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3bzqa_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3bzqA (A:)
ghmklitaivkpftlddvktsledagvlgmtvseiqgygrqkghtevyrgaeysvdfvpk
vrievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal
Sequence, based on observed residues (ATOM records): (download)
>3bzqA (A:)
ghmklitaivkpftlddvktsledagvlgmtvseiqgygrdfvpkvrievvvddsivdkv
vdsivraartgkigdgkvwvspvdtivrvrtgerghdal