PDB entry 3bpu

View 3bpu on RCSB PDB site
Description: Crystal structure of the 3rd PDZ domain of human membrane associated guanylate kinase, C677S and C709S double mutant
Class: transferase
Keywords: PDZ, MEMBRANE ASSOCIATED GUANYLATE KINASE, STRUCTURAL GENOMICS CONSORTIUM, SGC, ATP-binding, Cell junction, Nucleotide-binding, Phosphoprotein, Tight junction, Transferase
Deposited on 2007-12-19, released 2008-01-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.204
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: MAGI1, BAIAP1, BAP1, TNRC19
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96QZ7 (2-83)
    • expression tag (0-1)
    • engineered (39)
    • engineered (71)
    • expression tag (84-87)
  Domains in SCOPe 2.04: d3bpua_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3bpuA (A:)
  smelitvhivkgpmgfgftiadspggggqrvkqivdsprsrglkegdlivevnkknvqal
  thnqvvdmlvespkgsevtllvqrqtrl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3bpuA (A:)
  smelitvhivkgpmgfgftiadspggggqrvkqivdrsrglkegdlivevnkknvqalth
  nqvvdmlvespkgsevtllvqrqtrl