PDB entry 3b9i
View 3b9i on RCSB PDB site
Description: Crystal Structure of mouse GITRL at 2.5 A.
Class: cytokine
Keywords: GITRL; Glucocorticoid-Induced TNF Receptor Ligand, CYTOKINE, UNKNOWN FUNCTION
Deposited on
2007-11-05, released
2008-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.2
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: GITR ligand
Species: Mus musculus [TaxId:10090]
Gene: Tnfsf18, Gitrl
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3b9ia_ - Chain 'B':
Compound: GITR ligand
Species: Mus musculus [TaxId:10090]
Gene: Tnfsf18, Gitrl
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3b9ib_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3b9iA (A:)
gshmptaiescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkk
yikdnapfvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntyw
giilmpdlpfis
Sequence, based on observed residues (ATOM records): (download)
>3b9iA (A:)
scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
fis
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3b9iB (B:)
gshmptaiescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkk
yikdnapfvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntyw
giilmpdlpfis
Sequence, based on observed residues (ATOM records): (download)
>3b9iB (B:)
scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
fis