PDB entry 3azc

View 3azc on RCSB PDB site
Description: Crystal structure of the soluble part of cytochrome b6f complex iron-sulfur subunit from Thermosynechococcus elongatus BP-1
Class: oxidoreductase
Keywords: Rieske, cytochrome b6f complex, Thermosynechococcus elongatus, photosynthesis, electron transport, thylakoid membrane, OXIDOREDUCTASE
Deposited on 2011-05-23, released 2012-05-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b6-f complex iron-sulfur subunit
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: petC, tlr0959
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C8N8 (6-132)
      • expression tag (0-5)
    Domains in SCOPe 2.04: d3azca_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3azcA (A:)
    hhiegravakdalgndikvseylakhlpgdrslaqgikgdptyvivtedhqianyglnav
    cthlgcvvpwnvsenkficpchgsqydstgkvvrgpaplslalvkatvteddklvftpwt
    eidfrtgkepwwt