PDB entry 3aid
View 3aid on RCSB PDB site
Description: a new class of hiv-1 protease inhibitor: the crystallographic structure, inhibition and chemical synthesis of an aminimide peptide isostere
Class: aspartyl protease
Keywords: aspartyl protease, protease, hiv, peptide isostere inhibitor, drug design
Deposited on
1997-05-15, released
1997-09-17
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: human immunodeficiency virus protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3aida_ - Chain 'B':
Compound: human immunodeficiency virus protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3aidb_ - Heterogens: ARQ, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3aidA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3aidB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf