PDB entry 3afa

View 3afa on RCSB PDB site
Description: The human nucleosome structure
Class: structural protein/DNA
Keywords: histone-fold, DNA-binding protein, Chromosomal protein, Citrullination, DNA-binding, Methylation, Nucleosome core, Nucleus, Phosphoprotein, Isopeptide bond, Antibiotic, Antimicrobial, STRUCTURAL PROTEIN-DNA complex
Deposited on 2010-02-24, released 2010-05-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Histone H3.1
  Species: Homo sapiens [TaxId:9606]
  Gene: H3.1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68431
  Domains in SCOPe 2.02: d3afaa_
• Chain 'B':
  Compound: histone h4
  Species: Homo sapiens [TaxId:9606]
  Gene: H4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62805 (Start-105)
• Chain 'C':
  Compound: Histone H2A type 1-B/E
  Species: Homo sapiens [TaxId:9606]
  Gene: H2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04908
• Chain 'D':
  Compound: Histone H2B type 1-J
  Species: Homo sapiens [TaxId:9606]
  Gene: H2B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06899 (Start-128)
• Chain 'E':
  Compound: Histone H3.1
  Species: Homo sapiens [TaxId:9606]
  Gene: H3.1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68431 (Start-138)
  Domains in SCOPe 2.02: d3afae_
• Chain 'F':
  Compound: histone h4
  Species: Homo sapiens [TaxId:9606]
  Gene: H4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62805 (Start-105)
• Chain 'G':
  Compound: Histone H2A type 1-B/E
  Species: Homo sapiens [TaxId:9606]
  Gene: H2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04908
• Chain 'H':
  Compound: Histone H2B type 1-J
  Species: Homo sapiens [TaxId:9606]
  Gene: H2B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06899
• Chain 'I':
  Compound: 146-mer DNA
  
• Chain 'J':
  Compound: 146-mer DNA
  
• Heterogens: CL, MN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3afaA (A:)
  gshmartkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqk
  stellirklpfqrlvreiaqdfktdlrfqssavmalqeaceaylvglfedtnlcaihakr
  vtimpkdiqlarrirgera
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3afaA (A:)
  phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
  aylvglfedtnlcaihakrvtimpkdiqlarrirger
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >3afaE (E:)
  gshmartkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqk
  stellirklpfqrlvreiaqdfktdlrfqssavmalqeaceaylvglfedtnlcaihakr
  vtimpkdiqlarrirgera
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3afaE (E:)
  kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
  eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.