PDB entry 3ab9
View 3ab9 on RCSB PDB site
Description: Crystal Structure of lipoylated E. coli H-protein (reduced form)
Class: transport protein
Keywords: glycine cleavage system, Lipoyl, TRANSPORT PROTEIN
Deposited on
2009-12-04, released
2010-04-07
The last revision prior to the SCOPe 2.06 freeze date was dated
2013-08-21, with a file datestamp of
2013-08-16.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.205
AEROSPACI score: 0.55
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: glycine cleavage system H protein
Species: Escherichia coli [TaxId:83333]
Gene: GcvH
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3ab9a_ - Heterogens: CA, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3ab9A (A:)
msnvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcav
aesvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldat
ayeallede
Sequence, based on observed residues (ATOM records): (download)
>3ab9A (A:)
nvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcavae
svkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldatay
eallede