PDB entry 2zoi

View 2zoi on RCSB PDB site
Description: Neutron Crystal Structure of Photoactive Yellow Protein, Wild type, at 295K
Class: signaling protein
Keywords: PAS, LOV, PHOTORECEPTOR, LIGHT SENSOR, LBHB, SHB, Chromophore, Photoreceptor protein, Receptor, Sensory transduction, SIGNALING PROTEIN
Deposited on 2008-05-21, released 2009-03-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NEUT
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
  Gene: PYP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOPe 2.06: d2zoia_
• Heterogens: HC4, DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zoiA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv