PDB entry 2zit

View 2zit on RCSB PDB site
Description: Structure of the eEF2-ExoA-NAD+ complex
Class: biosynthetic protein/transferase
Keywords: elongation factor, toxin, ADP-ribosylation, toxin-substrate complex, Cytoplasm, GTP-binding, Nucleotide-binding, Phosphoprotein, Protein biosynthesis, RNA-binding, rRNA-binding, Glycosyltransferase, NAD, Transferase, BIOSYNTHETIC PROTEIN/TRANSFERASE COMPLEX
Deposited on 2008-02-24, released 2008-06-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Elongation factor 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32324 (Start-841)
• Chain 'B':
  Compound: exotoxin a
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: toxA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11439 (1-206)
    • expression tag (0)
    • see remark 999 (8)
    • see remark 999 (116)
  Domains in SCOPe 2.02: d2zitb1
• Chain 'C':
  Compound: Elongation factor 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32324 (Start-841)
• Chain 'D':
  Compound: exotoxin a
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: toxA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11439 (1-206)
    • expression tag (0)
    • see remark 999 (8)
    • see remark 999 (116)
  Domains in SCOPe 2.02: d2zitd1
• Chain 'E':
  Compound: Elongation factor 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32324 (Start-841)
• Chain 'F':
  Compound: exotoxin a
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: toxA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11439 (1-206)
    • expression tag (0)
    • see remark 999 (8)
    • see remark 999 (116)
  Domains in SCOPe 2.02: d2zitf1
• Heterogens: NAD

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zitB (B:)
  aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
  sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
  aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
  ggdldpssipdkeqaisalpdyasqpg
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zitD (D:)
  aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
  sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
  aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
  ggdldpssipdkeqaisalpdyasqpg
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zitF (F:)
  aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
  sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
  aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
  ggdldpssipdkeqaisalpdyasqpg