PDB entry 2zhc

View 2zhc on RCSB PDB site
Description: ParM filament
Class: cell cycle/protein fibril
Keywords: ParM, Plasmid, Plasmid partition, CELL CYCLE/PROTEIN FIBRIL COMPLEX
Deposited on 2008-02-04, released 2008-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 23.8 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasmid segregation protein parM
    Species: Escherichia coli [TaxId:562]
    Gene: parM, stbA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zhca1, d2zhca2
  • Heterogens: MG, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zhcA (A:)
    mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
    spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
    rkkanfrkkitlnggdtftikdvkvmpesipagyevlqeldeldslliidlggttldisq
    vmgklsgiskiygdsslgvslvtsavkdalslartkgssyladdiiihrkdnnylkqrin
    denkisivteamnealrkleqrvlntlnefsgythvmvigggaelicdavkkhtqirder
    ffktnnsqydlvngmylign