PDB entry 2zfd

View 2zfd on RCSB PDB site
Description: The crystal structure of plant specific calcium binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
Class: signaling protein/transferase
Keywords: calcium binding protein, protein-protein complex, ATP-binding, Kinase, Nucleotide-binding, Serine/threonine-protein kinase, Transferase, SIGNALING PROTEIN-TRANSFERASE COMPLEX
Deposited on 2007-12-29, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.18
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcineurin B-like protein 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CBL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zfda_
  • Chain 'B':
    Compound: Putative uncharacterized protein T20L15_90
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CIPK14
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zfdA (A:)
    msqcvdgikhlctsvlgcfdldlykqsgglgdpellardtvfsvseiealyelfkkissa
    viddglinkeefqlalfktnkkeslfadrvfdlfdtkhngilgfeefaralsvfhpnapi
    ddkihfsfqlydlkqqgfierqevkqmvvatlaesgmnlkdtviediidktfeeadtkhd
    gkidkeewrslvlrhpsllknmtlqylkditttfpsfvfhsqvedt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zfdA (A:)
    dpellardtvfsvseiealyelfkkissaviddglinkeefqlalfktnkkeslfadrvf
    dlfdtkhngilgfeefaralsvfhpnapiddkihfsfqlydlkqqgfierqevkqmvvat
    laesgmnlkdtviediidktfeeadtkhdgkidkeewrslvlrhpsllknmtlqylkdit
    ttf
    

  • Chain 'B':
    No sequence available.