Lineage for d2zfda_ (2zfd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710549Protein Calcineurin B-like protein 2 [101182] (1 species)
  7. 2710550Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101183] (2 PDB entries)
  8. 2710551Domain d2zfda_: 2zfd A: [154406]
    automated match to d1uhna_
    complexed with acy, ca

Details for d2zfda_

PDB Entry: 2zfd (more details), 1.2 Å

PDB Description: The crystal structure of plant specific calcium binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
PDB Compounds: (A:) calcineurin B-like protein 2

SCOPe Domain Sequences for d2zfda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfda_ a.39.1.5 (A:) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dpellardtvfsvseiealyelfkkissaviddglinkeefqlalfktnkkeslfadrvf
dlfdtkhngilgfeefaralsvfhpnapiddkihfsfqlydlkqqgfierqevkqmvvat
laesgmnlkdtviediidktfeeadtkhdgkidkeewrslvlrhpsllknmtlqylkdit
ttf

SCOPe Domain Coordinates for d2zfda_:

Click to download the PDB-style file with coordinates for d2zfda_.
(The format of our PDB-style files is described here.)

Timeline for d2zfda_: