PDB entry 2z4j

View 2z4j on RCSB PDB site
Description: Crystal structure of AR LBD with SHP peptide NR Box 2
Class: transcription
Keywords: Androgen receptor, ligand binding domain, SHP, Co-repressor, TRANSCRIPTION
Deposited on 2007-06-19, released 2007-12-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ar, Nr3c4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2z4ja_
  • Chain 'B':
    Compound: Nuclear receptor 0B2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2z4jA (A:)
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfht

  • Chain 'B':
    No sequence available.